Software, Program, Shareware, Freeware download  Software Downloads Home  |  Submit  |  Latest News  |  Category  |  Contact us    


Fleet Maintenance Pro Shop Edition 11.0.0.2

Date: 2008-05-16
File Size: 8096
Price: 949.00
Category: Business::Databases & Tools
Platform: Win98,WinME,WinNT 3.x,WinNT 4.x,Windows2000,WinXP,Windows2003,Windows Vista Star

Fleet Maintenance Pro Shop Edition - Fleet maintenance mgmt for shops. Track work orders, PM, repairs, parts, labor.



Fleet Maintenance Pro Shop Edition makes it easy to track preventive and repair maintenance on your fleet. Automated and color-coded alerts instantly show you which vehicles and equipment are due for service. Designed especially for shops, you can track repairs, generate work orders, and track parts inventory. Use the fleet history to monitor PM, repairs, parts, labor, and operating costs. Track vendors, fuel, drivers, registrations, and more.


  Fleet Maintenance Pro Shop Edition download
[Fleet Maintenance Pro Shop Edition screenshot]  [Innovative Maintenance Systems]

Fleet Maintenance Pro Shop Edition Related Search:

fleetmaintenancevehicleautoequipmentwork orderpartscartruckmachinerypmrepairlawnservicefuelgasdi

Fleet Maintenance Pro Shop Edition Related Titles:

Access to MySQL Database Converter - Convert MS Access to MySQL Database quickly and easily for increased control.

Mexico Postal Code Database (Premium Edition) - Mexican Postal Codes Database Subscription in text, Excel and Access

Mexico Postal Code Database (Gold Edition) - Mexican Postal Codes Database Subscription in text, Excel and Access

IP2Location IP-COUNTRY-REGION-CITY-LATITUDE-LONGIT - IP address to country, net speed, ISP, domain, latitude, longitude and zip code.

US ZIP Code Database Mixed Case Edition - United States ZIP Codes Database Subscription in text, Excel, Access and dBASE V

Area Code Database (Platinum Edition) - North American area codes NPA/NXX database one month subscription service.

SQL Data Examiner 2008 R2 - Compares and synchronizes data of SQL Server, Oracle, MySQL and Access databases

Auktionator im A-Deal Business Office - Professioneller Handel im Internet, auf eBay, eigenen Web-Shop und per Telefon

Access to MySQL Database Converter - Convert MS Access to MySQL Database quickly and easily for increased control.

MicroOLAP Database Designer for PostgreSQL - Visual development system for PostgreSQL database design and modeling

Geo Data German Admin - Geodata of Germany with towns, postal codes, preselections, landscapes ec.

Geodaten German Admin - Geodata of Germany with towns, postal codes, preselections, landscapes ec.

Free PDF to Word Converter - Free pdf to word, pdf to doc, pdf to rtf Converter!

SQL Partition Manager - Partition SQL Server databases through wizards in a point-and-click manner

MONyog MySQL Monitor - MONyog helps MySQL DBAs manage more MySQL servers, tune their current servers.

IP2Location IP-COUNTRY-REGION-CITY Database - IP2Location(tm) IP-COUNTRY-REGION-CITY translates IP address to country, region


Copyright © 2008 Annesoft Software Downloads, All rights reserved.